PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2128s0069.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 233aa    MW: 27070.3 Da    PI: 7.5611
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2128s0069.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-1880132456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            ++t+eql  Le +F+++ +++ e++ +LAk+l+L+ +qV vWFqNrRa++k
  Bostr.2128s0069.1.p  80 NKRLTSEQLASLELHFQEDFKLDSERKLKLAKELSLKPSQVAVWFQNRRARWK 132
                          5679************************************************9 PP

2HD-ZIP_I/II106.32.3e-3478166189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +k +rl++eq+++LE +F+e+ kL++erK +la+eL l+p qvavWFqnrRAR+k k+lE+ y++L+++y+a+ +e++ L++ev++Lr+
  Bostr.2128s0069.1.p  78 KKNKRLTSEQLASLELHFQEDFKLDSERKLKLAKELSLKPSQVAVWFQNRRARWKVKHLEESYDSLRQEYEAVWKEKQILHDEVKKLRA 166
                          589************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1866133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-1972139IPR009057Homeodomain-like
PROSITE profilePS5007116.61774134IPR001356Homeobox domain
SMARTSM003896.5E-1777138IPR001356Homeobox domain
CDDcd000861.53E-1478135No hitNo description
PfamPF000467.4E-1679132IPR001356Homeobox domain
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEWSMTSNVQ NERVDSMPPP WLESDYSNSL RSFNYNPYAG NSSNYPAYTQ TGPVISVPES  60
EKIINAYQCP SNNNEMIKKN KRLTSEQLAS LELHFQEDFK LDSERKLKLA KELSLKPSQV  120
AVWFQNRRAR WKVKHLEESY DSLRQEYEAV WKEKQILHDE VKKLRAIILR DQGLMMNINQ  180
IAGGGQTNVF YSVKETPHNK LICDVGEEAE SYNTKRSGFD DEQQPNRQRR SN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2142331e-100KM214233.1 Capsella grandiflora isolate C.g926a RCO-A (RCO-A) gene, complete cds.
GenBankKM2142341e-100KM214234.1 Capsella grandiflora isolate C.g926b RCO-A (RCO-A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871059.11e-112predicted protein
SwissprotQ9LZR02e-85ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLD7LWT81e-112D7LWT8_ARALL; Predicted protein
STRINGAl_scaffold_0006_2901e-112(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-86homeobox 51